HSP70 1A anticorps (Middle Region)

N° du produit ABIN629817

Cet anticorps anti-HSP70 1A est un anticorps Lapin Polyclonal détectant HSP70 1A dans WB. Adapté pour Humain, Souris, Rat, Chien, C. elegans et Poisson zèbre (Danio rerio).

Aperçu rapide pour HSP70 1A anticorps (Middle Region) (ABIN629817)

Antigène: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Reactivité: Humain, Souris, Rat, Chien, C. elegans, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSP70 1A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HSP70 1A anticorps

Épitope: Middle Region

Specificité: HSPA1 A antibody was raised against the middle region of HSPA1

Purification: Purified

Immunogène: HSPA1 A antibody was raised using the middle region of HSPA1 corresponding to a region with amino acids SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA1A Blocking Peptide, (ABIN5614097), is also available for use as a blocking control in assays to test for specificity of this HSPA1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSP70 1A

Antigène: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Autre désignation: HSPA1A

Sujet: HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process